PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0022s0032.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 710aa    MW: 76197.3 Da    PI: 8.2016
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0022s0032.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31447500255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Mapoly0022s0032.1.p 447 PRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 500
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-15444500IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-28445500IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-23447500IPR006447Myb domain, plants
PfamPF002491.6E-6448499IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MKMHENSYLS MPNIVSQYCP DLSLQISPPC SSAPFLVKHK KIPEKIDDDR GFDLWKRPQT  60
SNPRPATSVL SESSSNCSSA SDNLTSPDAA STQLCLANPS HRLPEVTTSK AASFTNSTPS  120
CFSKESATKQ PSLTTTATAI SAPGSTAGLA PHHQQQQQHH HHHHHHHQHQ QHQHQQQQQQ  180
QRHHNAAPST HHQAGQAPPS FLQDSHAKPA DSTKLFGSHD SSKSVYLTSF RGDLNTKFVL  240
PEPSTGYSNS GKAPAAVCYP CFPDVPAADP KAGIGRGARM EVSSGGDNLG LGGIGLRVSP  300
PYNHHLSYNS TGTTVRDSPH LSGTTTTNNN SDSREQHQQQ QQQQQLGLCS QILNLAGSGV  360
PFSSNGGEPT ALSHAGSNLL HKVVDGFSSM SPQAGNVGSS SINPQLSAGR SPVNPQSSVG  420
LLGDSQSSIV RSRFMSKLPS KRSMRAPRMR WTSTLHAHFV HAVELLGGHE RATPKSVLEL  480
MNVKDLTLAH VKSHLQMYRT VKTTDKPSNP SGQADSSSEI VTGGRKADDS ATPIVVDSDS  540
GQEGNTLSES GTDDVHQGGR FSLHMKQSLQ EYPSNLWANP DSMNRGAWSA REVAKGSQGR  600
QGSSGASDAV SWQPNTVPVP NFKAKDGAMG MMEQVAHFEP SMVEDAGCNS MQSRNQHLHM  660
VSASALSQLV SSQITQRITK MPNLEFTLGR PGWHDHADSP PTELLLLKC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-44G2-like family protein